31-10-2015
Mathematics

contestada

how could you find how many blocks there were in 20 stories

Respuesta :

snehatony101 snehatony101

01-11-2015

take the number of blocks and multiply it by the stories

Answer Link

Otras preguntas

Adoption of ASC Topic 842 related to leases represents a Multiple Choice o voluntary change in accounting principle.o mandatory change in accounti

When Washington wrote this speech, America was mostly:

Create a plan of study for passing the U. S. Citizenship civics test. Your plan should list at least three study tools you would use in order to prepare for the

Researchers in Japan conducted an experiment on 13 individuals who were extremely allergic to poison ivy. On one arm, each subject was rubbed with a poison ivy

What factors contributed to hitler rising to power in germany prior to world war ii?.

Find the surface area of a cylinder with a base radius of 4 yd and a height of 5 yd. Use the value 3.14 for pi, and do not do any rounding. Be sure to include t

**PLEASE HELP** Why are sodium (Na) and potassium (K) in the same group on the periodic table?A) They are both hard and brittle. B) They have similar reactivity

A membrane protein has the following amino acid sequence: EWDRHDFESGPTFIWLIWLVLAVLFLLLWAVLRPGKYKDKHE Considering the R groups on the amino acids, predict the re

cards and chips are being created for a board game by a company the number of cards produced as proportional to the number of chips that are produced over a sho

Who was Pyrrhus and what is meant by a Pyrrhic victory?