kdawgvu262 kdawgvu262

28-11-2022
Biology

contestada

A membrane protein has the following amino acid sequence: EWDRHDFESGPTFIWLIWLVLAVLFLLLWAVLRPGKYKDKHE Considering the R groups on the amino acids, predict the region of the protein that will be embedded within the membrane.

Respuesta :

Otras preguntas

different ways to make the number 15,638 with only hundreds,tens,and ones

find the product 7 x 300 = hundreds

helpme quickly worth 10 pts... On Thursday, a website received x advertisement orders. On Friday, the website received 8 more advertisement orders than on Thur

What three factors were used to create this product game board 4 6 9 14 49

You are drinking from a standard (10 oz) coffee cup when a fly starts buzzing around your hands. After finishing your beverage, you quickly trap the fly inside

What other form of government is political Communism closest to? a. Democracy b. Dictatorship c. Theocracy d. Good times e. Fascism f. Junta

benchmark estimate of 8.01

what is the value of the missing exponent in the expression below 523 ÷ 10□ = 52.3

solve this equation for the given variable 2m-nx=x+4 for x

compare the values of the underlined digits 2783 and 7283 the underlined digit is 2.

ACCESS MORE